Monoclonal Antibody Pain Control For Cat

pain Antibody

CSB-PA894300XA01DLU-02mg 0.2mg Ask for price
Description: Recombinant Drosophila melanogaster (Fruit fly) pain protein

Cat Monoclonal Laboratories manufactures the monoclonal antibody pain control for cat reagents distributed by Genprice. The Monoclonal Antibody Pain Control For Cat reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cat monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: Pain Control

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Pain Control information

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC051520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405M conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC051520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405M conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCA1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC811520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF680R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC811520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF680R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCH1520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCH1520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCP1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCR1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCAP1520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCAP1520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC551520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF555 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC551520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF555 conjugate, Concentration: 0.1mg/mL

Monoclonal Antibody For Zika As Control Line of Rapid Test

MBS596184-1mg 1mg
EUR 505

Monoclonal Antibody For Zika As Control Line of Rapid Test

MBS596184-2mg 2mg
EUR 855

Monoclonal Antibody For Zika As Control Line of Rapid Test

MBS596184-5mg 5mg
EUR 1895

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL

BNUM1520-50 50uL
EUR 396
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 0.2mg/mL

BNUB1520-100 100uL
EUR 225
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 0.2mg/mL

BNUB1520-500 500uL
EUR 485
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application

IgG2a Negative Control Monoclonal Antibody [278.427]

MBS375480-002mg 0.02mg
EUR 335

IgG2a Negative Control Monoclonal Antibody [278.427]

MBS375480-005mg 0.05mg
EUR 435

IgG2a Negative Control Monoclonal Antibody [278.427]

MBS375480-01mg 0.1mg
EUR 520

IgG2a Negative Control Monoclonal Antibody [278.427]

MBS375480-5x01mg 5x0.1mg
EUR 2125

IgG2a Negative Control Monoclonal Antibody [278.427]

MBS375481-005mg 0.05mg
EUR 770

IgG2a Negative Control Monoclonal Antibody [278.427]

MBS375481-5x005mg 5x0.05mg
EUR 3250

Anti-GAPDH Loading Control Monoclonal Antibody

G041 100 µg
EUR 215