Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Cat Monoclonal Laboratories manufactures the monoclonal antibody pain control for cat reagents distributed by Genprice. The Monoclonal Antibody Pain Control For Cat reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cat monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: Pain Control
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 471.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Pain Control information
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|
BNCAP1520-100 |
Biotium |
100uL |
EUR 238.8 |
|
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|
BNCAP1520-500 |
Biotium |
500uL |
EUR 652.8 |
|
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|
BNCH1520-100 |
Biotium |
100uL |
EUR 238.8 |
|
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|
BNCH1520-500 |
Biotium |
500uL |
EUR 652.8 |
|
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL |
Negative Control Antibody for Mouse Monoclonals |
|
V8785-100UG |
NSJ Bioreagents |
100ug |
EUR 424.15 |
|
|
|
Description: To serve as a true negative control for various procedures, this monoclonal IgG should be used under the identical conditions and at the same dilution as the rabbit monoclonal antibody being used for a positive reaction. |
Negative Control Antibody for Mouse Monoclonals |
|
V8785-20UG |
NSJ Bioreagents |
20ug |
EUR 186.15 |
|
|
|
Description: To serve as a true negative control for various procedures, this monoclonal IgG should be used under the identical conditions and at the same dilution as the rabbit monoclonal antibody being used for a positive reaction. |
Negative Control Antibody for Mouse Monoclonals |
|
V8785SAF-100UG |
NSJ Bioreagents |
100ug |
EUR 424.15 |
|
|
|
Description: To serve as a true negative control for various procedures, this monoclonal IgG should be used under the identical conditions and at the same dilution as the rabbit monoclonal antibody being used for a positive reaction. |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 0.2mg/mL |
|
BNUB1520-100 |
Biotium |
100uL |
EUR 225 |
|
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 0.2mg/mL |
|
BNUB1520-500 |
Biotium |
500uL |
EUR 485 |
|
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL |
|
BNUM1520-50 |
Biotium |
50uL |
EUR 396 |
|
Description: Primary and secondary antibodies for multiple methodologyimmunostaining detection application |
Rabbit Isotype Control Monoclonal Antibody |
|
V7260-100UG |
NSJ Bioreagents |
100 ug |
EUR 349.3 |
|
|
|
Description: Isotype control antibodies are negative controls used to measure non-specific binding or background levels of a primary antibody in different cell types. They are not specific to any target in a cell, yet retain all non-specific characteristics of the antibodies they control. |
Rabbit Isotype Control Monoclonal Antibody |
|
V7260-20UG |
NSJ Bioreagents |
20 ug |
EUR 153.3 |
|
|
|
Description: Isotype control antibodies are negative controls used to measure non-specific binding or background levels of a primary antibody in different cell types. They are not specific to any target in a cell, yet retain all non-specific characteristics of the antibodies they control. |
Rabbit Isotype Control Monoclonal Antibody |
|
V7260SAF-100UG |
NSJ Bioreagents |
100 ug |
EUR 349.3 |
|
|
|
Description: Isotype control antibodies are negative controls used to measure non-specific binding or background levels of a primary antibody in different cell types. They are not specific to any target in a cell, yet retain all non-specific characteristics of the antibodies they control. |
