Monoclonal Antibody Pain Control For Cat

Monoclonal CAT / Catalase Antibody

APG02431G 0.05ml
EUR 580.8
Description: A Monoclonal antibody against Human CAT / Catalase. The antibodies are raised in Mouse. This antibody is applicable in WB and IHC-P

Cat Monoclonal Laboratories manufactures the monoclonal antibody pain control for cat reagents distributed by Genprice. The Monoclonal Antibody Pain Control For Cat reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cat monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: Pain Control

True Blue

5mg Ask for price
Description: True Blue

Acpp (Pain System Marker) chicken polyclonal antibody, Aff - Purified

200 µl Ask for price

ELISA kit for Human True insulin (TI)

48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human True insulin (TI)

5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human True insulin (TI)

96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Pain Control information

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCP1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUB1520-100 100uL
EUR 250.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUB1520-500 500uL
EUR 549.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNUM1520-50 50uL
EUR 474
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), 1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC471520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC471520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF647 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC611520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF660R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC431520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC431520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF543 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC551520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF555 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC551520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF555 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC681520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC681520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL

Rabbit Isotype Control Monoclonal Antibody

V7260-100UG 100 ug
EUR 349.3
Description: Isotype control antibodies are negative controls used to measure non-specific binding or background levels of a primary antibody in different cell types. They are not specific to any target in a cell, yet retain all non-specific characteristics of the antibodies they control.